HPA026640

UTP25 antibody from Sigma-Aldrich
C1orf107, DEF, DIEXF, MGC29875
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026640, RRID:AB_2067139
Product name
Anti-C1orf107 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026640
Antibody type
Polyclonal
Antigen
Digestive organ expansion factor homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGAL
QDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVL
VQLPHVFQRMEAENLASVIDARFNFFVNKILPQYR
DAVM
Storage
-20C
Provider Type Product Number
- No reagents -