HPA019445

KCNH1 antibody from MilliporeSigma / Merck KGaA
eag, eag1, h-eag, Kv10.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019445
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019445, RRID:AB_1852118
Product name
Anti-KCNH1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019445
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily H member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKH
SFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNI
EKQLSEILRILTSRRSSQSPQELFEISRPQSPES
Storage
-20C
Provider Type Product Number
- No reagents -