HPA015275

SLC30A1 antibody from Atlas Antibodies
ZNT1, ZRC1

Antibody data

Product number
HPA015275
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015275, RRID:AB_1857083
Product name
Anti-SLC30A1
Provider product page
Atlas Antibodies - HPA015275
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRP
GSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLD
PADPENPRSGDTVEVQVNGNLVREPDHMELEEDRA
GQLNMRGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.