HPA026763

NENF antibody from Sigma-Aldrich
CIR2, SCIRP10, SPUF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026763
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026763, RRID:AB_1854379
Product name
Anti-NENF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026763
Antibody type
Polyclonal
Antigen
Neudesin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGK
EFYGRGAPYNALTGKDSTRGVAKMS
Storage
-20C
Provider Type Product Number
- No reagents -