Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028982-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028982-M05, RRID:AB_606256
- Product name
- FLVCR monoclonal antibody (M05), clone 4B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FLVCR.
- Antigen sequence
MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKES
VELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTP
LAPEEETQARLLP- Isotype
- IgG
- Antibody clone number
- 4B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Heme-oxygenases during erythropoiesis in K562 and human bone marrow cells.
Alves LR, Costa ES, Sorgine MH, Nascimento-Silva MC, Teodosio C, Bárcena P, Castro-Faria-Neto HC, Bozza PT, Orfao A, Oliveira PL, Maya-Monteiro CM
PloS one 2011;6(7):e21358
PloS one 2011;6(7):e21358
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FLVCR expression in transfected 293T cell line by FLVCR monoclonal antibody (M05), clone 4B2.Lane 1: FLVCR transfected lysate(59.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FLVCR1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol