Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182396 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Estrogen-Related Receptor gamma (ESRRG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the middle region of human ESRRG
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPE
KIYAM PDPTVPDSDI- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A conserved gene structure and expression regulation of miR-433 and miR-127 in mammals.
Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma.
Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma.
Song G, Wang L
PloS one 2009 Nov 25;4(11):e7829
PloS one 2009 Nov 25;4(11):e7829
Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma.
Song G, Wang L
Nucleic acids research 2008 Oct;36(18):5727-35
Nucleic acids research 2008 Oct;36(18):5727-35
Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma.
Hentschke M, Borgmeyer U
Biochemical and biophysical research communications 2003 Dec 26;312(4):975-82
Biochemical and biophysical research communications 2003 Dec 26;312(4):975-82
No comments: Submit comment
No validations: Submit validation data