HPA027181

GPATCH2 antibody from Sigma-Aldrich
CT110, FLJ10252, GPATC2, Pfa1, PPP1R30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027181
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027181, RRID:AB_10602601
Product name
Anti-GPATCH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027181
Antibody type
Polyclonal
Antigen
G patch domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEK
EDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQ
ARLSRLHGMSSKNIKKSGGTPTSMVPIPGPV
Storage
-20C
Provider Type Product Number
- No reagents -