HPA007981

RPS6KA1 antibody from Atlas Antibodies
HU-1, MAPKAPK1, p90Rsk, RSK1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007981
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007981, RRID:AB_1079850
Product name
Anti-RPS6KA1
Provider product page
Atlas Antibodies - HPA007981
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSH
QDLQLVKGAMAATYSALNSSKPTPQLKPIESSILA
QRRVRKLPSTTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -