HPA007981

RPS6KA1 antibody from Sigma-Aldrich
HU-1, p90Rsk, RSK, RSK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007981
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007981, RRID:AB_1079850
Product name
Anti-RPS6KA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007981
Antibody type
Polyclonal
Antigen
Ribosomal protein S6 kinase alpha-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSH
QDLQLVKGAMAATYSALNSSKPTPQLKPIESSILA
QRRVRKLPSTTL
Storage
-20C
Provider Type Product Number
- No reagents -