Antibody data

Product number
H00051018-M03
Provider
Abnova Corporation
Product name
RRP15 monoclonal antibody (M03), clone 1F6
Provider product page
Abnova Corporation - H00051018-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RRP15.
Antigen sequence
MKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYS
DDDAIEADSEGDAEPCDKENENDGESSVGTNMGWA
DAMAKVLNKKTPESKPTILVKNKKLEKEKEKLKQE
RLEKIKQRDKRLEWEMMCRVKPDVVQDKETERNLQ
RIATRGVVQLFNAVQKHQKNVDEKVKEAGSSMRKR
AKLISTVSKKDFISVLRGMDGSTNETASSRKKPKA
KQTEVKSEEGPGWTILRDDFMMGASMKDWDKESDG
PDDSRPESASDSDT
Isotype
IgG
Antibody clone number
1F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -