HPA026490

EPRS1 antibody from MilliporeSigma / Merck KGaA
EARS, EPRS, GLUPRORS, PARS, QARS, QPRS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026490
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026490, RRID:AB_1855979
Product name
Anti-EPRS antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026490
Antibody type
Polyclonal
Antigen
Bifunctional aminoacyl-tRNA synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLL
SVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVG
PRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAIL
Storage
-20C
Provider Type Product Number
- No reagents -