HPA024596

IARS2 antibody from Sigma-Aldrich
FLJ10326
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024596
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024596, RRID:AB_1851370
Product name
Anti-IARS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024596
Antibody type
Polyclonal
Antigen
Isoleucyl-tRNA synthetase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTK
DEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLP
KEVLSEVGGPDALEYVPGQD
Storage
-20C
Provider Type Product Number
- No reagents -