HPA026273

RAB3GAP2 antibody from Atlas Antibodies
DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026273
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026273, RRID:AB_1856007
Product name
Anti-RAB3GAP2
Provider product page
Atlas Antibodies - HPA026273
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQ
SLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDI
DTIIDHASVGIMTLSPFDQMKTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -