PAB21794

RAB3GAP2 antibody from Abnova Corporation
DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69

Antibody data

Product number
PAB21794
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21794, RRID:AB_10964978
Product name
RAB3GAP2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21794
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RAB3GAP2.
Antigen sequence
TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQ
SLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDI
DTIIDHASVGIMTLSPFDQMKTA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -