HPA026273

RAB3GAP2 antibody from Sigma-Aldrich
DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026273
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026273, RRID:AB_1856007
Product name
Anti-RAB3GAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026273
Antibody type
Polyclonal
Antigen
Rab3 GTPase-activating protein non-catalytic subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQ
SLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDI
DTIIDHASVGIMTLSPFDQMKTA
Storage
-20C
Provider Type Product Number
- No reagents -