HPA027299

RAB3GAP2 antibody from MilliporeSigma / Merck KGaA
DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027299
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027299, RRID:AB_1856008
Product name
Anti-RAB3GAP2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027299
Antibody type
Polyclonal
Antigen
Rab3 GTPase-activating protein non-catalytic subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAF
FKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAV
QAQHSATKVKDPT
Storage
-20C
Provider Type Product Number
- No reagents -