HPA017238

NRK antibody from MilliporeSigma / Merck KGaA
DKFZp686A17109
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017238
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017238, RRID:AB_1854645
Product name
Anti-NRK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017238
Antibody type
Polyclonal
Antigen
Nik-related protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPP
VYLTNEWVGYNALSEIFRNDWLTPAPVIQPPEEDG
DYVELYDASADTDGDDDDESNDTFEDTYDHANGND
DLDNQVDQANDVCKD
Storage
-20C
Provider Type Product Number
- No reagents -