HPA024470

CAPN2 antibody from Sigma-Aldrich
CANPL2, CANPml, mCANP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024470
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024470, RRID:AB_1845925
Product name
Anti-CAPN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024470
Antibody type
Polyclonal
Antigen
Calpain-2 catalytic subunit Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFE
LQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSD
GSGKLGLKEFYILWTKIQKYQKIYREIDVD
Storage
-20C
Provider Type Product Number
- No reagents -