HPA021603

TP53BP2 antibody from Atlas Antibodies
53BP2, ASPP2, PPP1R13A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021603
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021603, RRID:AB_1844384
Product name
Anti-TP53BP2
Provider product page
Atlas Antibodies - HPA021603
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGK
NFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQ
QQHPENIYSNSQGKPGSPEPETEPVSSVQENHENE
RI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -