HPA021603

TP53BP2 antibody from Sigma-Aldrich
53BP2, ASPP2, PPP1R13A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021603, RRID:AB_1844384
Product name
Anti-TP53BP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021603
Antibody type
Polyclonal
Antigen
Apoptosis-stimulating of p53 protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGK
NFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQ
QQHPENIYSNSQGKPGSPEPETEPVSSVQENHENE
RI
Storage
-20C
Provider Type Product Number
- No reagents -