H00008560-M01A

DEGS1 antibody from Abnova Corporation
DEGS-1, Des-1, DES1, FADS7, MLD

Antibody data

Product number
H00008560-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008560-M01A, RRID:AB_1137162
Product name
DEGS1 monoclonal antibody (M01A), clone 3F9
Provider product page
Abnova Corporation - H00008560-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DEGS1.
Antigen sequence
SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHN
EHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIK
VLYDFVMDDTISPYSRMKRHQKGEMVLE
Isotype
IgM
Antibody clone number
3F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -