HPA014763

DEGS1 antibody from Sigma-Aldrich
DEGS-1, Des-1, DES1, FADS7, MLD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014763
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014763, RRID:AB_1847597
Product name
Anti-DEGS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014763
Antibody type
Polyclonal
Antigen
Sphingolipid delta(4)-desaturase DES1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REDFEWVYTDQPHADRRREILAKYPEIKSLMKPDP
N
Storage
-20C
Provider Type Product Number
- No reagents -