HPA007458

PNCK antibody from Sigma-Aldrich
CaMK1b, MGC45419
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007458
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007458, RRID:AB_1079644
Product name
Anti-PNCK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007458
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQER
GSAHLVALKCIPKKALRGKEALVENEIAVLRRISH
PN
Storage
-20C
Provider Type Product Number
- No reagents -