Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108250 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mix Paired-Like Homeobox (MIXL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human MIXL1
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSP
AAALLPAPPAGPGPA- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Differential expression of the human MIXL1 gene product in non-Hodgkin and Hodgkin lymphomas.
Mixl1 and oct4 proteins are transiently co-expressed in differentiating mouse and human embryonic stem cells.
Drakos E, Rassidakis GZ, Leventaki V, Guo W, Medeiros LJ, Nagarajan L
Human pathology 2007 Mar;38(3):500-7
Human pathology 2007 Mar;38(3):500-7
Mixl1 and oct4 proteins are transiently co-expressed in differentiating mouse and human embryonic stem cells.
Mossman AK, Sourris K, Ng E, Stanley EG, Elefanty AG
Stem cells and development 2005 Dec;14(6):656-63
Stem cells and development 2005 Dec;14(6):656-63
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Heart; WB Suggested Anti-MIXL1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart; MIXL1 antibody - N-terminal region (AP42010PU-N) in Human Heart cells using Western Blot
