Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056997-M04A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056997-M04A, RRID:AB_1016722
- Product name
- CABC1 monoclonal antibody (M04A), clone 7G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CABC1.
- Antigen sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGE
LIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAE
NFGGPEGEFHFSVPHAAGASTDFSSASAPD- Isotype
- IgM
- Antibody clone number
- 7G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The clinical heterogeneity of coenzyme Q10 deficiency results from genotypic differences in the Coq9 gene.
The effects of an ActRIIb receptor Fc fusion protein ligand trap in juvenile simian immunodeficiency virus-infected rhesus macaques.
Luna-Sánchez M, Díaz-Casado E, Barca E, Tejada MÁ, Montilla-García Á, Cobos EJ, Escames G, Acuña-Castroviejo D, Quinzii CM, López LC
EMBO molecular medicine 2015 May;7(5):670-87
EMBO molecular medicine 2015 May;7(5):670-87
The effects of an ActRIIb receptor Fc fusion protein ligand trap in juvenile simian immunodeficiency virus-infected rhesus macaques.
O'Connell KE, Guo W, Serra C, Beck M, Wachtman L, Hoggatt A, Xia D, Pearson C, Knight H, O'Connell M, Miller AD, Westmoreland SV, Bhasin S
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2015 Apr;29(4):1165-75
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2015 Apr;29(4):1165-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CABC1 monoclonal antibody (M04A), clone 7G1 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ).