Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009475-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009475-M02, RRID:AB_805029
- Product name
- ROCK2 monoclonal antibody (M02), clone 1E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ROCK2.
- Antigen sequence
KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIA
PCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKI
PKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLA
PNKPS- Isotype
- IgG
- Antibody clone number
- 1E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Vascular hyperpermeability in response to inflammatory mustard oil is mediated by Rho kinase in mice systemically exposed to arsenic.
Chen SC, Liu CC, Huang SY, Chiou SJ
Microvascular research 2011 Sep;82(2):182-9
Microvascular research 2011 Sep;82(2):182-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol