HPA028003

PRSS38 antibody from Sigma-Aldrich
MPN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028003
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028003, RRID:AB_1853572
Product name
Anti-MPN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028003
Antibody type
Polyclonal
Antigen
Serine protease MPN2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLTSANCWATGWGLVSKQGETSDELQEMQLPLILE
PWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDS
Storage
-20C
Provider Type Product Number
- No reagents -