HPA007633

MAP3K7 antibody from Sigma-Aldrich
MEKK7, TAK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007633, RRID:AB_1079359
Product name
Anti-MAP3K7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007633
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLM
RYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIA
STNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAK
QQSESGRLS
Storage
-20C
Provider Type Product Number
- No reagents -