Antibody data

Product number
H00051127-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051127-M01, RRID:AB_1205117
Product name
TRIM17 monoclonal antibody (M01), clone 2E11
Provider product page
Abnova Corporation - H00051127-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TRIM17.
Antigen sequence
LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLF
CQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKL
KLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVK
ERRER
Isotype
IgG
Antibody clone number
2E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -