Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503967 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mitogen-Activated Protein Kinase 4 (MAPK4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDE
PTSQH PFRIEDEIDD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human biliverdin reductase is an ERK activator; hBVR is an ERK nuclear transporter and is required for MAPK signaling.
Lerner-Marmarosh N, Miralem T, Gibbs PE, Maines MD
Proceedings of the National Academy of Sciences of the United States of America 2008 May 13;105(19):6870-5
Proceedings of the National Academy of Sciences of the United States of America 2008 May 13;105(19):6870-5
No comments: Submit comment
No validations: Submit validation data