HPA007461

MAPK4 antibody from Sigma-Aldrich
Erk3-related, Erk4, PRKM4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007461, RRID:AB_1079308
Product name
Anti-MAPK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007461
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVSLS
SDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDP
RKDSHSSSERFLEQSHSSMERAFEADYGRSCDYKV
GSPSYLDKLL
Storage
-20C
Provider Type Product Number
- No reagents -