Antibody data

Product number
H00010753-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010753-M02, RRID:AB_529977
Product name
CAPN9 monoclonal antibody (M02), clone 3A6
Provider product page
Abnova Corporation - H00010753-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CAPN9.
Antigen sequence
DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGF
QLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLEN
ASRVFQALSTKNKEFIHLNINEFIHLTMNI
Isotype
IgG
Antibody clone number
3A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -