HPA025073

SPRTN antibody from Atlas Antibodies
C1orf124, DKFZP547N043, DVC1, Spartan

Antibody data

Product number
HPA025073
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025073, RRID:AB_1847695
Product name
Anti-SPRTN
Provider product page
Atlas Antibodies - HPA025073
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVG
NIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVM
PSQDVSGSEDT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.