HPA025073

C1orf124, DKFZP547N043, DVC1, Spartan

Antibody data

Submit

Validation data

Product number: HPA025073
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025073, RRID:AB_1847695
Product name: Anti-SPRTN
Provider product page: Atlas Antibodies - HPA025073
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVG NIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVM PSQDVSGSEDT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows nuclear positivity in a single cells in the basal layer of epidermis.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using HPA025073 antibody. Corresponding SPRTN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.