HPA025073

SPRTN antibody from Sigma-Aldrich
C1orf124, DKFZP547N043, DVC1, Spartan
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025073, RRID:AB_1847695
Product name
Anti-C1orf124 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025073
Antibody type
Polyclonal
Antigen
Zinc finger RAD18 domain-containing protein C1orf124 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVG
NIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVM
PSQDVSGSEDT
Storage
-20C
Provider Type Product Number
- No reagents -