HPA001749

TOM1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001749
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001749, RRID:AB_1080323
Product name
Anti-TOM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001749
Antibody type
Polyclonal
Antigen
Target of Myb protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEML
TELVPTQAEPADLELLQELNRTCRAMQQRVLELIP
QIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQ
TTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMN
LGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLA
DQ
Storage
-20C
Provider Type Product Number
- No reagents -