HPA007636

MAP3K21 antibody from Sigma-Aldrich
KIAA1804, MLK4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007636, RRID:AB_1079392
Product name
Anti-MAK3K19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007636
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNPTPTGATIISATGASALPLCPSPAPHSHLPREV
SPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVS
QLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLD
ADVEGQSRDYTVPLCRMRSKTSRPSIYELEKE
Storage
-20C
Provider Type Product Number
- No reagents -