HPA016049

KCNK1 antibody from Sigma-Aldrich
DPK, K2p1.1, TWIK-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016049, RRID:AB_1855571
Product name
Anti-KCNK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016049
Antibody type
Polyclonal
Antigen
Potassium channel subfamily K member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQ
KQNEPFVATQSSACVDGPAN
Storage
-20C
Provider Type Product Number
- No reagents -