HPA007637

NTRK2 antibody from Sigma-Aldrich
TRKB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007637, RRID:AB_1080385
Product name
Anti-NTRK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007637
Antibody type
Polyclonal
Antigen
BDNF/NT-3 growth factors receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFY
NGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHM
NNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGAN
PNYPDVIYEDYGTAANDIGDTTNRSNEIP
Storage
-20C
Provider Type Product Number
- No reagents -