HPA018836

EDARADD antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018836, RRID:AB_1847984
Product name
Anti-EDARADD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018836
Antibody type
Polyclonal
Antigen
Ectodysplasin-A receptor-associated adapter protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFAS
KWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQL
MELCRLYHRADVEKVLRRWVDEEWPKRERGDP
Storage
-20C
Provider Type Product Number
- No reagents -