HPA004937

FMN2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004937, RRID:AB_1848961
Product name
Anti-FMN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004937
Antibody type
Polyclonal
Antigen
Formin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKID
QEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSP
NAFFSIWHEFSSDFKDFWKKENKLLLQER
Storage
-20C
Provider Type Product Number
- No reagents -