HPA010650

TAOK2 antibody from Sigma-Aldrich
KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010650, RRID:AB_1080204
Product name
Anti-TAOK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010650
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase TAO2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SISASSQSSSVNSLADASDNEEEEEEEEEEEEEEE
GPEAREMAMMQEGEHTVTSHSSIIHRLPGSDNLYD
DPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRN
RD
Storage
-20C
Provider Type Product Number
- No reagents -