WH0001122M3

CHML antibody from MilliporeSigma / Merck KGaA
REP-2
ELISA
Recommended by provider

Antibody data

Product number
WH0001122M3
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0001122M3, RRID:AB_1840681
Product name
Monoclonal Anti-CHML antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0001122M3
Antibody type
Monoclonal
Antigen
CHML (NP_001812, a.a. 68-178) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
IGEESTVVWQDLIHETEEAITLRKKDETIQHTEAF
CYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDS
ALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDV
EESVE* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -