Antibody data

Product number
PAB21689
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21689, RRID:AB_10966947
Product name
ADSS polyclonal antibody
Provider product page
Abnova Corporation - PAB21689
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ADSS.
Antigen sequence
KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDIS
NARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKS
RESM
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.