HPA024400

ADSS2 antibody from Sigma-Aldrich
ADSS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024400
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024400, RRID:AB_1844623
Product name
Anti-ADSS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024400
Antibody type
Polyclonal
Antigen
Adenylosuccinate synthetase isozyme 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDIS
NARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKS
RESM
Storage
-20C
Provider Type Product Number
- No reagents -