HPA007641

FER antibody from Sigma-Aldrich
PPP1R74, TYK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007641
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007641, RRID:AB_1078845
Product name
Anti-FER antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007641
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase FER recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEES
SETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEA
KFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVT
SMERKERLSKFESIRHSIAGIIRSPKS
Storage
-20C
Provider Type Product Number
- No reagents -