Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183828 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 496 (ZNF496) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the N terminal of human ZNF496
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGEL
PSPES SRRLFRRFRY- Vial size
- 0.1 mg
Submitted references Towards a proteome-scale map of the human protein-protein interaction network.
Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M
Nature 2005 Oct 20;437(7062):1173-8
Nature 2005 Oct 20;437(7062):1173-8
No comments: Submit comment
No validations: Submit validation data