HPA011753

CAMK4 antibody from Sigma-Aldrich
CaMK-GR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011753, RRID:AB_1845950
Product name
Anti-CAMK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011753
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type IV recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQA
LEKVKGADINAEEAPKMVPKAVEDGIKVADLELEE
GLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ
Storage
-20C
Provider Type Product Number
- No reagents -