HPA010537

LRRK1 antibody from Sigma-Aldrich
FLJ23119, KIAA1790, RIPK6, Roco1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010537
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010537, RRID:AB_1079283
Product name
Anti-LRRK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010537
Antibody type
Polyclonal
Antigen
Leucine-rich repeat serine/threonine-protein kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMCPLNTPQQALDTPAVVTCFLAVPVIKKNSYLVL
AGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKF
SIADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLL
VIDCASLEICRRLEPYMAPSMVTSVVCSS
Storage
-20C
Provider Type Product Number
- No reagents -