HPA023637

TRIM58 antibody from Sigma-Aldrich
BIA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023637, RRID:AB_1858309
Product name
Anti-TRIM58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023637
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICD
ATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL
Storage
-20C
Provider Type Product Number
- No reagents -