Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023043-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023043-M01, RRID:AB_566243
- Product name
- TNIK monoclonal antibody (M01), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TNIK.
- Antigen sequence
MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAV
SDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADS
FSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHI
NLPDL- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2.Lane 1: TNIK transfected lysate(60.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TNIK monoclonal antibody (M01), clone 2D2. Western Blot analysis of TNIK expression in U-2 OS ( Cat # L022V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TNIK is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol